PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G090700.1.p
Common NameGLYMA_20G090700, Glyma20g22230.1, LOC778072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 429aa    MW: 48288.6 Da    PI: 7.2491
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G090700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Glyma.20G090700.1.p 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding43.66.9e-1467110146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg+++++E+  +v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Glyma.20G090700.1.p  67 RGAFSQQEENMIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                          89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466892.46E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-161461IPR001005SANT/Myb domain
CDDcd001676.37E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.8566116IPR017930Myb domain
SMARTSM007173.5E-1266114IPR001005SANT/Myb domain
PfamPF002491.5E-1267111IPR001005SANT/Myb domain
CDDcd001671.89E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENMIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPNTHKPLS EVENEKDMMP PSTDKSTQKA SVGSNEVSLV DHHQQQPKIM PNSSSERYPL  180
EVSTTSSTQE LFLDRFGTPT TCHHHHNNNN TSDVVGSYFS FQHLNYGTTT NMSLSANPNA  240
SLCFVPASTS SDLNNNSTIT SSMLPSIFPT QHVKLQSNNN NPSISSDGVQ NWETSNLNNS  300
NSTNKNNGSM QLQSCTNFID NTWGVGESMK VVNINKDADQ MPLQAEQEDL KWSEYLNTPF  360
ILGNNTAQNH QIHTSQSIYS EVKPETGFIT DESCATWHHY QNQTPAFQLS DIYSKDLQRF  420
SVTFGQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.66790.0seed coat| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312060.0KT031206.1 Glycine max clone HN_CCL_131 MYB/HD-like transcription factor (Glyma20g22230.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555168.10.0PREDICTED: transcription factor MYB86
RefseqXP_006605773.10.0PREDICTED: transcription factor MYB86
TrEMBLI1NET40.0I1NET4_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA20G22230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-113myb domain protein 61
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]